Lineage for d5hufc1 (5huf C:0-321)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776284Species Influenza A virus (a/gyrfalcon/washington/41088-6/2014(h5n8)) [TaxId:1589663] [315438] (1 PDB entry)
  8. 2776286Domain d5hufc1: 5huf C:0-321 [316795]
    Other proteins in same PDB: d5hufa2, d5hufb1, d5hufb2, d5hufc2, d5hufd1, d5hufd2, d5hufe2, d5huff1, d5huff2
    automated match to d3hmga_
    complexed with nag

Details for d5hufc1

PDB Entry: 5huf (more details), 2.81 Å

PDB Description: the crystal structure of hemagglutinin from a/gyrfalcon/washington/41088-6/2014 influenza virus
PDB Compounds: (C:) hemagglutinin HA1

SCOPe Domain Sequences for d5hufc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hufc1 b.19.1.0 (C:0-321) automated matches {Influenza A virus (a/gyrfalcon/washington/41088-6/2014(h5n8)) [TaxId: 1589663]}
sdqicigyhannstkqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsvag
wllgnpmcdefirvpewsyiveranpandlcypgtlndyeelkhllsrinhfektliipr
sswpnhetslgvsaacpyqgassffrnvvwlikkndayptikisynntnredllilwgih
hsnnaaeqtnlyknpdtyvsvgtstlnqrlvpkiatrsqvngqsgrmdffwtilkpndai
hfesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnihplti
gecpkyvksnklvlatglrnsp

SCOPe Domain Coordinates for d5hufc1:

Click to download the PDB-style file with coordinates for d5hufc1.
(The format of our PDB-style files is described here.)

Timeline for d5hufc1: