![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus (a/gyrfalcon/washington/41088-6/2014(h5n8)) [TaxId:1589663] [315438] (1 PDB entry) |
![]() | Domain d5hufc1: 5huf C:0-321 [316795] Other proteins in same PDB: d5hufa2, d5hufb1, d5hufb2, d5hufc2, d5hufd1, d5hufd2, d5hufe2, d5huff1, d5huff2 automated match to d3hmga_ complexed with nag |
PDB Entry: 5huf (more details), 2.81 Å
SCOPe Domain Sequences for d5hufc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hufc1 b.19.1.0 (C:0-321) automated matches {Influenza A virus (a/gyrfalcon/washington/41088-6/2014(h5n8)) [TaxId: 1589663]} sdqicigyhannstkqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsvag wllgnpmcdefirvpewsyiveranpandlcypgtlndyeelkhllsrinhfektliipr sswpnhetslgvsaacpyqgassffrnvvwlikkndayptikisynntnredllilwgih hsnnaaeqtnlyknpdtyvsvgtstlnqrlvpkiatrsqvngqsgrmdffwtilkpndai hfesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnihplti gecpkyvksnklvlatglrnsp
Timeline for d5hufc1: