SCOPe 2.07: Domain d5i4na1: 5i4n A:537-809

Lineage for d5i4na1 (5i4n A:537-809)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries)

8. Domain d5i4na1: 5i4n A:537-809 [316790]
   Other proteins in same PDB: d5i4na2
   automated match to d3ekna_
   complexed with atp, gol, mg; mutant

Details for d5i4na1

PDB Entry: 5i4n, 1.54 Å

PDB Description: crystal structure of the e596a v617f mutant jak2 pseudokinase domain bound to mg-atp

PDB Compounds: (A:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d5i4na1:

Sequence; same for both SEQRES and ATOM records:

>d5i4na1 d.144.1.0 (A:537-809) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhkirnedlifneslgqgtftkifkgvrrevgdygqlhetevllkvldkahrnysesffa
aasmmsklshkhlvlnygvcfcgdenilvqefvkfgsldtylkknkncinilwklevakq
laaamhfleentlihgnvcaknillireedrktgnppfiklsdpgisitvlpkdilqeri
pwvppecienpknlnlatdkwsfgttlweicsggdkplsaldsqrklqfyedrhqlpapk
aaelanlinncmdyepdhrpsfraiirdlnslf

Timeline for d5i4na1:

• d5i4na1 first appeared in SCOPe 2.06
  
• d5i4na1 appears in the current release, SCOPe 2.08