SCOPe 2.06: Domain d5hufe1: 5huf E:0-321

Lineage for d5hufe1 (5huf E:0-321)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (34 species)
   not a true protein

7. Species Influenza a virus (a/gyrfalcon/washington/41088-6/2014(h5n8)) [TaxId:1589663] [315438] (1 PDB entry)

8. Domain d5hufe1: 5huf E:0-321 [316787]
   Other proteins in same PDB: d5hufa2, d5hufb1, d5hufb2, d5hufc2, d5hufd1, d5hufd2, d5hufe2, d5huff1, d5huff2
   automated match to d3hmga_
   complexed with man, nag

Details for d5hufe1

PDB Entry: 5huf, 2.81 Å

PDB Description: the crystal structure of hemagglutinin from a/gyrfalcon/washington/41088-6/2014 influenza virus

PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d5hufe1:

Sequence; same for both SEQRES and ATOM records:

>d5hufe1 b.19.1.0 (E:0-321) automated matches {Influenza a virus (a/gyrfalcon/washington/41088-6/2014(h5n8)) [TaxId: 1589663]}
sdqicigyhannstkqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsvag
wllgnpmcdefirvpewsyiveranpandlcypgtlndyeelkhllsrinhfektliipr
sswpnhetslgvsaacpyqgassffrnvvwlikkndayptikisynntnredllilwgih
hsnnaaeqtnlyknpdtyvsvgtstlnqrlvpkiatrsqvngqsgrmdffwtilkpndai
hfesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnihplti
gecpkyvksnklvlatglrnsp

Timeline for d5hufe1:

• d5hufe1 is new in SCOPe 2.06-stable
  
• d5hufe1 appears in SCOPe 2.07
  
• d5hufe1 appears in the current release, SCOPe 2.08