SCOPe 2.08: Domain d5fykl2: 5fyk L:107-210

Lineage for d5fykl2 (5fyk L:107-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5fykl2: 5fyk L:107-210 [316786]
   Other proteins in same PDB: d5fyke1, d5fykh_, d5fykl1, d5fyku_, d5fykv_
   automated match to d4ocrl2
   complexed with nag

Details for d5fykl2

PDB Entry: 5fyk, 3.11 Å

PDB Description: crystal structure at 3.7 a resolution of fully glycosylated hiv-1 clade b jr-fl sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122, 35o22 and vrc01

PDB Compounds: (L:) pgt122

SCOPe Domain Sequences for d5fykl2:

Sequence; same for both SEQRES and ATOM records:

>d5fykl2 b.1.1.2 (L:107-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttps
kqsnnkyaassylsltpeqwkshksyscqvthegstvektvapt

Timeline for d5fykl2:

• d5fykl2 first appeared in SCOPe 2.06
  
• d5fykl2 appears in SCOPe 2.07