Lineage for d5hu8e1 (5hu8 E:1-319)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.19: Viral protein domain [49817] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll; form trimersSuperfamily b.19.1: Viral protein domain [49818] (4 families) 
forms homotrimers
Family b.19.1.0: automated matches [227246] (1 protein)
not a true familyProtein automated matches [227017] (57 species)
not a true proteinSpecies Unidentified influenza virus [TaxId:11309] [225763] (9 PDB entries) 
Domain d5hu8e1: 5hu8 E:1-319 [316776]
Other proteins in same PDB: d5hu8a2, d5hu8b_, d5hu8c2, d5hu8d_, d5hu8e2, d5hu8f_
automated match to d3hmga_
complexed with fuc, nag
Details for d5hu8e1
PDB Entry: 5hu8 (more details), 2.45 Å
PDB Description: the crystal structure of hemagglutinin from a/sichuan/26221/2014 (h5n6) influenza virus
PDB Compounds: (E:) hemagglutinin HA1SCOPe Domain Sequences for d5hu8e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hu8e1 b.19.1.0 (E:1-319) automated matches {Unidentified influenza virus [TaxId: 11309]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsvagw
llgnpmcdefirvpewsyiveranpandlcypgnlndyeelkhllsrinhfekiliipks
swtnhetslgvsaacpyqgtpsffrnvvwlikkndayptikisynntnqedllilwgvhh
snnaaeqtnlyknpttyisvgtstlnqrlvpkiatrsqvngqrgrmdffwtilkpndaih
fesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnihpltig
ecpkyvksnklvlatglrn
SCOPe Domain Coordinates for d5hu8e1:
Click to download the PDB-style file with coordinates for d5hu8e1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5hu8e1:
View in 3D
