![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Unidentified influenza virus [TaxId:11309] [225763] (9 PDB entries) |
![]() | Domain d5hu8e1: 5hu8 E:1-319 [316776] Other proteins in same PDB: d5hu8a2, d5hu8b_, d5hu8c2, d5hu8d_, d5hu8e2, d5hu8f_ automated match to d3hmga_ complexed with nag |
PDB Entry: 5hu8 (more details), 2.45 Å
SCOPe Domain Sequences for d5hu8e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hu8e1 b.19.1.0 (E:1-319) automated matches {Unidentified influenza virus [TaxId: 11309]} dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsvagw llgnpmcdefirvpewsyiveranpandlcypgnlndyeelkhllsrinhfekiliipks swtnhetslgvsaacpyqgtpsffrnvvwlikkndayptikisynntnqedllilwgvhh snnaaeqtnlyknpttyisvgtstlnqrlvpkiatrsqvngqrgrmdffwtilkpndaih fesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnihpltig ecpkyvksnklvlatglrn
Timeline for d5hu8e1: