Lineage for d5hraa2 (5hra A:117-230)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2514740Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) (S)
  5. 2514759Family c.78.2.0: automated matches [227233] (1 protein)
    not a true family
  6. 2514760Protein automated matches [226982] (4 species)
    not a true protein
  7. 2514761Species Escherichia coli [TaxId:1330457] [316737] (3 PDB entries)
  8. 2514765Domain d5hraa2: 5hra A:117-230 [316771]
    Other proteins in same PDB: d5hraa3, d5hrab3
    automated match to d3ojca2
    complexed with das

Details for d5hraa2

PDB Entry: 5hra (more details), 1.6 Å

PDB Description: crystal structure of an aspartate/glutamate racemase in complex with d-aspartate
PDB Compounds: (A:) aspartate/glutamate racemase

SCOPe Domain Sequences for d5hraa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hraa2 c.78.2.0 (A:117-230) automated matches {Escherichia coli [TaxId: 1330457]}
mtrvallgtrytmeqdfyrgrlteqfsinclipeaderakinqiifeelclgqfteasra
yyaqviarlaeqgaqgvifgcteigllvpeersvlpvfdtaaihaedavafmls

SCOPe Domain Coordinates for d5hraa2:

Click to download the PDB-style file with coordinates for d5hraa2.
(The format of our PDB-style files is described here.)

Timeline for d5hraa2: