SCOPe 2.08: Domain d5hraa2: 5hra A:117-230

Lineage for d5hraa2 (5hra A:117-230)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families)

5. Family c.78.2.0: automated matches [227233] (1 protein)
   not a true family

6. Protein automated matches [226982] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:1330457] [316737] (3 PDB entries)

8. Domain d5hraa2: 5hra A:117-230 [316771]
   Other proteins in same PDB: d5hraa3, d5hrab3
   automated match to d3ojca2
   complexed with das

Details for d5hraa2

PDB Entry: 5hra, 1.6 Å

PDB Description: crystal structure of an aspartate/glutamate racemase in complex with d-aspartate

PDB Compounds: (A:) aspartate/glutamate racemase

SCOPe Domain Sequences for d5hraa2:

Sequence; same for both SEQRES and ATOM records:

>d5hraa2 c.78.2.0 (A:117-230) automated matches {Escherichia coli [TaxId: 1330457]}
mtrvallgtrytmeqdfyrgrlteqfsinclipeaderakinqiifeelclgqfteasra
yyaqviarlaeqgaqgvifgcteigllvpeersvlpvfdtaaihaedavafmls

Timeline for d5hraa2:

• d5hraa2 first appeared in SCOPe 2.06
  
• d5hraa2 appears in SCOPe 2.07