![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) ![]() |
![]() | Family c.78.2.0: automated matches [227233] (1 protein) not a true family |
![]() | Protein automated matches [226982] (4 species) not a true protein |
![]() | Species Escherichia coli [TaxId:1330457] [316737] (3 PDB entries) |
![]() | Domain d5hraa1: 5hra A:1-116 [316770] Other proteins in same PDB: d5hraa3, d5hrab3 automated match to d3ojca1 complexed with das |
PDB Entry: 5hra (more details), 1.6 Å
SCOPe Domain Sequences for d5hraa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hraa1 c.78.2.0 (A:1-116) automated matches {Escherichia coli [TaxId: 1330457]} mktigllggmswestipyyrlinegikqrlgglhsaqvllhsvdfheieecqrrgewdkt gdilaeaalglqragaegivlctntmhkvadaiesrctlpflhiadatgraitgag
Timeline for d5hraa1: