SCOPe 2.07: Domain d5huff1: 5huf F:1-174

Lineage for d5huff1 (5huf F:1-174)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (26 species)
   not a true protein

7. Species Influenza A virus (a/gyrfalcon/washington/41088-6/2014(h5n8)) [TaxId:1589663] [316757] (1 PDB entry)

8. Domain d5huff1: 5huf F:1-174 [316766]
   Other proteins in same PDB: d5hufa1, d5hufa2, d5hufb2, d5hufc1, d5hufc2, d5hufd2, d5hufe1, d5hufe2, d5huff2
   automated match to d3m5jb_
   complexed with man, nag

Details for d5huff1

PDB Entry: 5huf, 2.81 Å

PDB Description: the crystal structure of hemagglutinin from a/gyrfalcon/washington/41088-6/2014 influenza virus

PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d5huff1:

Sequence; same for both SEQRES and ATOM records:

>d5huff1 h.3.1.0 (F:1-174) automated matches {Influenza A virus (a/gyrfalcon/washington/41088-6/2014(h5n8)) [TaxId: 1589663]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypkyseeailkreeis

Timeline for d5huff1:

• d5huff1 first appeared in SCOPe 2.06