Lineage for d5huff1 (5huf F:1-174)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3041862Species Influenza A virus (a/gyrfalcon/washington/41088-6/2014(h5n8)) [TaxId:1589663] [316757] (1 PDB entry)
  8. 3041865Domain d5huff1: 5huf F:1-174 [316766]
    Other proteins in same PDB: d5hufa1, d5hufa2, d5hufb2, d5hufc1, d5hufc2, d5hufd2, d5hufe1, d5hufe2, d5huff2
    automated match to d3m5jb_
    complexed with nag

Details for d5huff1

PDB Entry: 5huf (more details), 2.81 Å

PDB Description: the crystal structure of hemagglutinin from a/gyrfalcon/washington/41088-6/2014 influenza virus
PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d5huff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5huff1 h.3.1.0 (F:1-174) automated matches {Influenza A virus (a/gyrfalcon/washington/41088-6/2014(h5n8)) [TaxId: 1589663]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypkyseeailkreeis

SCOPe Domain Coordinates for d5huff1:

Click to download the PDB-style file with coordinates for d5huff1.
(The format of our PDB-style files is described here.)

Timeline for d5huff1: