SCOPe 2.08: Domain d5fyle2: 5fyl E:108-210

Lineage for d5fyle2 (5fyl E:108-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5fyle2: 5fyl E:108-210 [316764]
   Other proteins in same PDB: d5fyle1, d5fylh_, d5fyll1
   automated match to d2fb4l2
   complexed with nag

Details for d5fyle2

PDB Entry: 5fyl, 3.1 Å

PDB Description: crystal structure at 3.7 a resolution of fully glycosylated hiv-1 clade a bg505 sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122 and 35o22

PDB Compounds: (E:) 35o22 antibody fab light chain

SCOPe Domain Sequences for d5fyle2:

Sequence; same for both SEQRES and ATOM records:

>d5fyle2 b.1.1.2 (E:108-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qskanpsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

Timeline for d5fyle2:

• d5fyle2 first appeared in SCOPe 2.06
  
• d5fyle2 appears in SCOPe 2.07