Lineage for d5hqta1 (5hqt A:1-116)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2907332Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) (S)
  5. 2907351Family c.78.2.0: automated matches [227233] (1 protein)
    not a true family
  6. 2907352Protein automated matches [226982] (4 species)
    not a true protein
  7. 2907353Species Escherichia coli [TaxId:1330457] [316737] (3 PDB entries)
  8. 2907354Domain d5hqta1: 5hqt A:1-116 [316760]
    Other proteins in same PDB: d5hqta3
    automated match to d3ojca1
    complexed with nhe

Details for d5hqta1

PDB Entry: 5hqt (more details), 1.6 Å

PDB Description: crystal structure of an aspartate/glutamate racemase from escherichia coli o157
PDB Compounds: (A:) aspartate/glutamate racemase

SCOPe Domain Sequences for d5hqta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hqta1 c.78.2.0 (A:1-116) automated matches {Escherichia coli [TaxId: 1330457]}
mktigllggmswestipyyrlinegikqrlgglhsaqvllhsvdfheieecqrrgewdkt
gdilaeaalglqragaegivlctntmhkvadaiesrctlpflhiadatgraitgag

SCOPe Domain Coordinates for d5hqta1:

Click to download the PDB-style file with coordinates for d5hqta1.
(The format of our PDB-style files is described here.)

Timeline for d5hqta1: