| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
| Protein automated matches [254645] (42 species) not a true protein |
| Species Influenza A virus (a/gyrfalcon/washington/41088-6/2014(h5n8)) [TaxId:1589663] [316757] (1 PDB entry) |
| Domain d5hufd1: 5huf D:1-174 [316758] Other proteins in same PDB: d5hufa1, d5hufa2, d5hufb2, d5hufc1, d5hufc2, d5hufd2, d5hufe1, d5hufe2, d5huff2 automated match to d3m5jb_ complexed with nag |
PDB Entry: 5huf (more details), 2.81 Å
SCOPe Domain Sequences for d5hufd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hufd1 h.3.1.0 (D:1-174) automated matches {Influenza A virus (a/gyrfalcon/washington/41088-6/2014(h5n8)) [TaxId: 1589663]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypkyseeailkreeis
Timeline for d5hufd1: