Lineage for d5hjpd1 (5hjp D:219-461)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2336144Protein automated matches [190059] (14 species)
    not a true protein
  7. 2336166Species Human (Homo sapiens) [TaxId:9606] [187214] (157 PDB entries)
  8. 2336407Domain d5hjpd1: 5hjp D:219-461 [316755]
    Other proteins in same PDB: d5hjpa2, d5hjpb2, d5hjpc2, d5hjpd2
    automated match to d1p8da_
    complexed with 668, peg

Details for d5hjpd1

PDB Entry: 5hjp (more details), 2.6 Å

PDB Description: identification of lxrbeta selective agonists for the treatment of alzheimer's disease
PDB Compounds: (D:) oxysterols receptor lxr-beta

SCOPe Domain Sequences for d5hjpd1:

Sequence, based on SEQRES records: (download)

>d5hjpd1 a.123.1.1 (D:219-461) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpasgsasqqrfahftelaiis
vqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskd
dfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqp
yveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd
vhe

Sequence, based on observed residues (ATOM records): (download)

>d5hjpd1 a.123.1.1 (D:219-461) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwpsasqqrfahftelaiisvqeivdfa
kqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhraglq
vefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsy
trikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdvhe

SCOPe Domain Coordinates for d5hjpd1:

Click to download the PDB-style file with coordinates for d5hjpd1.
(The format of our PDB-style files is described here.)

Timeline for d5hjpd1: