Lineage for d5hu8a1 (5hu8 A:1-319)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776786Species Unidentified influenza virus [TaxId:11309] [225763] (9 PDB entries)
  8. 2776790Domain d5hu8a1: 5hu8 A:1-319 [316753]
    Other proteins in same PDB: d5hu8a2, d5hu8b_, d5hu8c2, d5hu8d_, d5hu8e2, d5hu8f_
    automated match to d3hmga_
    complexed with nag

Details for d5hu8a1

PDB Entry: 5hu8 (more details), 2.45 Å

PDB Description: the crystal structure of hemagglutinin from a/sichuan/26221/2014 (h5n6) influenza virus
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d5hu8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hu8a1 b.19.1.0 (A:1-319) automated matches {Unidentified influenza virus [TaxId: 11309]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsvagw
llgnpmcdefirvpewsyiveranpandlcypgnlndyeelkhllsrinhfekiliipks
swtnhetslgvsaacpyqgtpsffrnvvwlikkndayptikisynntnqedllilwgvhh
snnaaeqtnlyknpttyisvgtstlnqrlvpkiatrsqvngqrgrmdffwtilkpndaih
fesngnfiapeyaykivkkgdstimksemeyghcntkcqtpigainssmpfhnihpltig
ecpkyvksnklvlatglrn

SCOPe Domain Coordinates for d5hu8a1:

Click to download the PDB-style file with coordinates for d5hu8a1.
(The format of our PDB-style files is described here.)

Timeline for d5hu8a1: