Lineage for d5hrab1 (5hra B:1-116)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) (S)
  5. Family c.78.2.0: automated matches [227233] (1 protein)
    not a true family
  6. Protein automated matches [226982] (4 species)
    not a true protein
  7. Species Escherichia coli [TaxId:1330457] [316737] (3 PDB entries)
  8. Domain d5hrab1: 5hra B:1-116 [316750]
    Other proteins in same PDB: d5hraa3, d5hrab3
    automated match to d3ojca1
    complexed with das

Details for d5hrab1

PDB Entry: 5hra (more details), 1.6 Å

PDB Description: crystal structure of an aspartate/glutamate racemase in complex with d-aspartate
PDB Compounds: (B:) aspartate/glutamate racemase

SCOPe Domain Sequences for d5hrab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hrab1 c.78.2.0 (B:1-116) automated matches {Escherichia coli [TaxId: 1330457]}
mktigllggmswestipyyrlinegikqrlgglhsaqvllhsvdfheieecqrrgewdkt
gdilaeaalglqragaegivlctntmhkvadaiesrctlpflhiadatgraitgag

SCOPe Domain Coordinates for d5hrab1 are not available.

Timeline for d5hrab1:

Domains from same chain:
(mouse over for more information)
d5hrab2, d5hrab3
Domains from other chains:
(mouse over for more information)
d5hraa1, d5hraa2, d5hraa3