Lineage for d5hjpc1 (5hjp C:299-528)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2342566Protein automated matches [190059] (14 species)
    not a true protein
  7. 2342588Species Human (Homo sapiens) [TaxId:9606] [187214] (212 PDB entries)
  8. 2342939Domain d5hjpc1: 5hjp C:299-528 [316748]
    Other proteins in same PDB: d5hjpa2, d5hjpb2, d5hjpc2, d5hjpd2
    automated match to d4j5wd_
    complexed with 668, peg

Details for d5hjpc1

PDB Entry: 5hjp (more details), 2.6 Å

PDB Description: identification of lxrbeta selective agonists for the treatment of alzheimer's disease
PDB Compounds: (C:) Retinoic acid receptor RXR-beta

SCOPe Domain Sequences for d5hjpc1:

Sequence, based on SEQRES records: (download)

>d5hjpc1 a.123.1.1 (C:299-528) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlvewakrip
hfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsagvgaifd
rvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasletyckqk
ypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemlea

Sequence, based on observed residues (ATOM records): (download)

>d5hjpc1 a.123.1.1 (C:299-528) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpvdrileaelavepvtnicqaadkqlftlvewakriphfsslplddqvillragwnell
iasfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdktelgc
lraiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalrsig
lkclehlfffkligdtpidtflmemlea

SCOPe Domain Coordinates for d5hjpc1:

Click to download the PDB-style file with coordinates for d5hjpc1.
(The format of our PDB-style files is described here.)

Timeline for d5hjpc1: