Lineage for d5fyje2 (5fyj E:108-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752065Domain d5fyje2: 5fyj E:108-210 [316747]
    Other proteins in same PDB: d5fyje1, d5fyjh_, d5fyjl1, d5fyju_, d5fyjv_
    automated match to d2fb4l2
    complexed with cit, edo, nag

Details for d5fyje2

PDB Entry: 5fyj (more details), 3.11 Å

PDB Description: crystal structure at 3.4 a resolution of fully glycosylated hiv-1 clade g x1193.c1 sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122, 35o22 and vrc01
PDB Compounds: (E:) 35o22

SCOPe Domain Sequences for d5fyje2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fyje2 b.1.1.2 (E:108-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qskanpsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d5fyje2:

Click to download the PDB-style file with coordinates for d5fyje2.
(The format of our PDB-style files is described here.)

Timeline for d5fyje2: