Lineage for d5hjpa1 (5hjp A:299-528)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729657Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)
  8. 2729896Domain d5hjpa1: 5hjp A:299-528 [316727]
    Other proteins in same PDB: d5hjpa2, d5hjpb1, d5hjpb2, d5hjpc2, d5hjpd1, d5hjpd2
    automated match to d4j5wd_
    complexed with 668, peg

Details for d5hjpa1

PDB Entry: 5hjp (more details), 2.6 Å

PDB Description: identification of lxrbeta selective agonists for the treatment of alzheimer's disease
PDB Compounds: (A:) Retinoic acid receptor RXR-beta

SCOPe Domain Sequences for d5hjpa1:

Sequence, based on SEQRES records: (download)

>d5hjpa1 a.123.1.1 (A:299-528) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlvewakrip
hfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsagvgaifd
rvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasletyckqk
ypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemlea

Sequence, based on observed residues (ATOM records): (download)

>d5hjpa1 a.123.1.1 (A:299-528) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpvdrileaelavevtnicqaadkqlftlvewakriphfsslplddqvillragwnelli
asfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdktelgcl
raiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalrsigl
kclehlfffkligdtpidtflmemlea

SCOPe Domain Coordinates for d5hjpa1:

Click to download the PDB-style file with coordinates for d5hjpa1.
(The format of our PDB-style files is described here.)

Timeline for d5hjpa1: