SCOPe 2.08: Domain d5fyke1: 5fyk E:2-107

Lineage for d5fyke1 (5fyk E:2-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5fyke1: 5fyk E:2-107 [316723]
   Other proteins in same PDB: d5fyke2, d5fykl2
   automated match to d2mcg11
   complexed with nag

Details for d5fyke1

PDB Entry: 5fyk, 3.11 Å

PDB Description: crystal structure at 3.7 a resolution of fully glycosylated hiv-1 clade b jr-fl sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122, 35o22 and vrc01

PDB Compounds: (E:) 35o22

SCOPe Domain Sequences for d5fyke1:

Sequence; same for both SEQRES and ATOM records:

>d5fyke1 b.1.1.0 (E:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapgis
prfsgyksywsayltisdlrpedettyyccsythnsgcvfgtgtkvsvlg

Timeline for d5fyke1:

• d5fyke1 first appeared in SCOPe 2.06
  
• d5fyke1 appears in SCOPe 2.07