SCOPe 2.08: Domain d5fvla1: 5fvl A:1-82

Lineage for d5fvla1 (5fvl A:1-82)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.14: MIT domain [116846] (2 families)

5. Family a.7.14.0: automated matches [191520] (1 protein)
   not a true family

6. Protein automated matches [190877] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188239] (3 PDB entries)

8. Domain d5fvla1: 5fvl A:1-82 [316721]
   Other proteins in same PDB: d5fvla2
   automated match to d4niqa_

Details for d5fvla1

PDB Entry: 5fvl, 1.97 Å

PDB Description: crystal structure of vps4-vps20 complex from s.cerevisiae

PDB Compounds: (A:) vacuolar protein sorting-associated protein 4

SCOPe Domain Sequences for d5fvla1:

Sequence; same for both SEQRES and ATOM records:

>d5fvla1 a.7.14.0 (A:1-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirakf
teylnraeqlkkhleseeanaa

Timeline for d5fvla1:

• d5fvla1 first appeared in SCOPe 2.06
  
• d5fvla1 appears in SCOPe 2.07