SCOPe 2.08: Domain d5fkna1: 5fkn A:3-67

Lineage for d5fkna1 (5fkn A:3-67)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [316666] (1 PDB entry)

8. Domain d5fkna1: 5fkn A:3-67 [316710]
   Other proteins in same PDB: d5fkna2, d5fkna3, d5fknb2, d5fknb3
   automated match to d1a6ia1
   complexed with cl, mg, tdc; mutant

Details for d5fkna1

PDB Entry: 5fkn, 1.8 Å

PDB Description: tetr(d) t103a mutant in complex with anhydrotetracycline and magnesium, p4(3)2(1)2

PDB Compounds: (A:) tetracycline repressor, class d, t103a mutant

SCOPe Domain Sequences for d5fkna1:

Sequence; same for both SEQRES and ATOM records:

>d5fkna1 a.4.1.0 (A:3-67) automated matches {Escherichia coli [TaxId: 83333]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys

Timeline for d5fkna1:

• d5fkna1 first appeared in SCOPe 2.06
  
• d5fkna1 appears in SCOPe 2.07