Lineage for d5fknb2 (5fkn B:68-208)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334734Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2334735Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2334736Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2335065Protein automated matches [226970] (6 species)
    not a true protein
  7. 2335093Species Escherichia coli [TaxId:83333] [316668] (1 PDB entry)
  8. 2335095Domain d5fknb2: 5fkn B:68-208 [316669]
    Other proteins in same PDB: d5fkna1, d5fkna3, d5fknb1, d5fknb3
    automated match to d2xpwa2
    complexed with cl, mg, tdc; mutant

Details for d5fknb2

PDB Entry: 5fkn (more details), 1.8 Å

PDB Description: tetr(d) t103a mutant in complex with anhydrotetracycline and magnesium, p4(3)2(1)2
PDB Compounds: (B:) tetracycline repressor, class d, t103a mutant

SCOPe Domain Sequences for d5fknb2:

Sequence, based on SEQRES records: (download)

>d5fknb2 a.121.1.1 (B:68-208) automated matches {Escherichia coli [TaxId: 83333]}
lpaageswqsflrnnamsfrrallryrdgakvhlgarpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d5fknb2 a.121.1.1 (B:68-208) automated matches {Escherichia coli [TaxId: 83333]}
lpaageswqsflrnnamsfrrallryrdgakvhlgarpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpanlppllrealqimdsddgeqaflhgle
slirgfevqltallqiv

SCOPe Domain Coordinates for d5fknb2:

Click to download the PDB-style file with coordinates for d5fknb2.
(The format of our PDB-style files is described here.)

Timeline for d5fknb2: