Lineage for d5fkkb2 (5fkk B:68-208)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728220Protein automated matches [226970] (6 species)
    not a true protein
  7. 2728237Species Escherichia coli [TaxId:562] [226229] (9 PDB entries)
  8. 2728242Domain d5fkkb2: 5fkk B:68-208 [316664]
    Other proteins in same PDB: d5fkka1, d5fkka3, d5fkkb1, d5fkkb3
    automated match to d2xpwa2
    complexed with cl, mg, pg4, pge, so4, tdc; mutant

Details for d5fkkb2

PDB Entry: 5fkk (more details), 1.75 Å

PDB Description: tetr(d) n82a mutant in complex with anhydrotetracycline and magnesium
PDB Compounds: (B:) tetracycline repressor, class d

SCOPe Domain Sequences for d5fkkb2:

Sequence, based on SEQRES records: (download)

>d5fkkb2 a.121.1.1 (B:68-208) automated matches {Escherichia coli [TaxId: 562]}
lpaageswqsflrnaamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d5fkkb2 a.121.1.1 (B:68-208) automated matches {Escherichia coli [TaxId: 562]}
lpaageswqsflrnaamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaalppllrealqimdsddgeqaflhgleslirgfe
vqltallqiv

SCOPe Domain Coordinates for d5fkkb2:

Click to download the PDB-style file with coordinates for d5fkkb2.
(The format of our PDB-style files is described here.)

Timeline for d5fkkb2: