Lineage for d5fkma1 (5fkm A:3-67)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2304502Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305405Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2305406Protein automated matches [190674] (22 species)
    not a true protein
  7. 2305430Species Escherichia coli [TaxId:562] [226228] (11 PDB entries)
  8. 2305434Domain d5fkma1: 5fkm A:3-67 [316658]
    Other proteins in same PDB: d5fkma2, d5fkma3
    automated match to d1a6ia1
    complexed with cl, mg, tdc; mutant

Details for d5fkma1

PDB Entry: 5fkm (more details), 1.63 Å

PDB Description: tetr(d) t103a mutant in complex with anhydrotetracycline and magnesium, i4(1)22
PDB Compounds: (A:) tetracycline repressor, class d

SCOPe Domain Sequences for d5fkma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fkma1 a.4.1.0 (A:3-67) automated matches {Escherichia coli [TaxId: 562]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys

SCOPe Domain Coordinates for d5fkma1:

Click to download the PDB-style file with coordinates for d5fkma1.
(The format of our PDB-style files is described here.)

Timeline for d5fkma1: