| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
| Protein automated matches [190674] (25 species) not a true protein |
| Species Escherichia coli [TaxId:562] [226228] (11 PDB entries) |
| Domain d5fkla1: 5fkl A:3-67 [316655] Other proteins in same PDB: d5fkla2, d5fkla3 automated match to d1a6ia1 complexed with cl, mg, so4, tdc; mutant |
PDB Entry: 5fkl (more details), 1.9 Å
SCOPe Domain Sequences for d5fkla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fkla1 a.4.1.0 (A:3-67) automated matches {Escherichia coli [TaxId: 562]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys
Timeline for d5fkla1: