Lineage for d5fkla1 (5fkl A:3-67)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692752Species Escherichia coli [TaxId:562] [226228] (11 PDB entries)
  8. 2692762Domain d5fkla1: 5fkl A:3-67 [316655]
    Other proteins in same PDB: d5fkla2, d5fkla3
    automated match to d1a6ia1
    complexed with cl, mg, so4, tdc; mutant

Details for d5fkla1

PDB Entry: 5fkl (more details), 1.9 Å

PDB Description: tetr(d) h100a mutant in complex with anhydrotetracycline and magnesium
PDB Compounds: (A:) tetracycline repressor, class d

SCOPe Domain Sequences for d5fkla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fkla1 a.4.1.0 (A:3-67) automated matches {Escherichia coli [TaxId: 562]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys

SCOPe Domain Coordinates for d5fkla1:

Click to download the PDB-style file with coordinates for d5fkla1.
(The format of our PDB-style files is described here.)

Timeline for d5fkla1: