SCOPe 2.08: Domain d5emia1: 5emi A:437-614

Lineage for d5emia1 (5emi A:437-614)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.0: automated matches [191553] (1 protein)
   not a true family

6. Protein automated matches [190955] (7 species)
   not a true protein

7. Species Nostoc punctiforme [TaxId:63737] [313755] (1 PDB entry)

8. Domain d5emia1: 5emi A:437-614 [316649]
   Other proteins in same PDB: d5emia2
   automated match to d1jwqa_
   complexed with mes, mrd, zn

Details for d5emia1

PDB Entry: 5emi, 1.12 Å

PDB Description: n-acetylmuramoyl-l-alanine amidase amic2 of nostoc punctiforme

PDB Compounds: (A:) Cell wall hydrolase/autolysin

SCOPe Domain Sequences for d5emia1:

Sequence; same for both SEQRES and ATOM records:

>d5emia1 c.56.5.0 (A:437-614) automated matches {Nostoc punctiforme [TaxId: 63737]}
gkllvvidpghggkdsgapglggllekdvilpigkrvaaileqhgvqavltrdadffvel
qgrveiaervnatafvsihansvdnrpdvnglevyyydsgyalaevvrntilqnidtikn
rgtrkarfyvlrkssmpsilvetgymtgrednprlasreyqnqmaeaiargilkylqr

Timeline for d5emia1:

• d5emia1 first appeared in SCOPe 2.06
  
• d5emia1 appears in SCOPe 2.07