Lineage for d5emia1 (5emi A:437-614)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2890040Family c.56.5.0: automated matches [191553] (1 protein)
    not a true family
  6. 2890041Protein automated matches [190955] (7 species)
    not a true protein
  7. 2890054Species Nostoc punctiforme [TaxId:63737] [313755] (1 PDB entry)
  8. 2890055Domain d5emia1: 5emi A:437-614 [316649]
    Other proteins in same PDB: d5emia2
    automated match to d1jwqa_
    complexed with mes, mrd, zn

Details for d5emia1

PDB Entry: 5emi (more details), 1.12 Å

PDB Description: n-acetylmuramoyl-l-alanine amidase amic2 of nostoc punctiforme
PDB Compounds: (A:) Cell wall hydrolase/autolysin

SCOPe Domain Sequences for d5emia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5emia1 c.56.5.0 (A:437-614) automated matches {Nostoc punctiforme [TaxId: 63737]}
gkllvvidpghggkdsgapglggllekdvilpigkrvaaileqhgvqavltrdadffvel
qgrveiaervnatafvsihansvdnrpdvnglevyyydsgyalaevvrntilqnidtikn
rgtrkarfyvlrkssmpsilvetgymtgrednprlasreyqnqmaeaiargilkylqr

SCOPe Domain Coordinates for d5emia1:

Click to download the PDB-style file with coordinates for d5emia1.
(The format of our PDB-style files is described here.)

Timeline for d5emia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5emia2