SCOPe 2.08: Domain d5ep4a1: 5ep4 A:141-387

Lineage for d5ep4a1 (5ep4 A:141-387)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Photobacterium angustum [TaxId:661] [316059] (4 PDB entries)

8. Domain d5ep4a1: 5ep4 A:141-387 [316641]
   Other proteins in same PDB: d5ep4a2
   automated match to d1ojlb_
   complexed with atp, edo, epe

Details for d5ep4a1

PDB Entry: 5ep4, 1.5 Å

PDB Description: structure, regulation, and inhibition of the quorum-sensing signal integrator luxo

PDB Compounds: (A:) Putative repressor protein luxO

SCOPe Domain Sequences for d5ep4a1:

Sequence; same for both SEQRES and ATOM records:

>d5ep4a1 c.37.1.0 (A:141-387) automated matches {Photobacterium angustum [TaxId: 661]}
gfignslpmqavyrviesaasskatvfitgesgtgkevcaeaihaasprhdkpfialnca
aipkdlieselfghvkgaftgasterqgavemahngtlmldelcemdldlqskllrfiqt
gtyqkvgsskmssvdvrfvcatnrnpweevqegrfredlyyrlhvipislpplrerggdi
ieiahallglmsleegksfsrfsepvlrlfesyswpgnvrelqnvirnivvlntddevkl
emvpppi

Timeline for d5ep4a1:

• d5ep4a1 first appeared in SCOPe 2.06
  
• d5ep4a1 appears in SCOPe 2.07