Lineage for d4ysnb1 (4ysn B:1-441)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2148904Species Lactobacillus buchneri [TaxId:1581] [316142] (4 PDB entries)
  8. 2148906Domain d4ysnb1: 4ysn B:1-441 [316634]
    Other proteins in same PDB: d4ysna2, d4ysnb2, d4ysnc2, d4ysnd2
    automated match to d3oksa_
    complexed with plp

Details for d4ysnb1

PDB Entry: 4ysn (more details), 1.94 Å

PDB Description: structure of aminoacid racemase in complex with plp
PDB Compounds: (B:) Putative 4-aminobutyrate aminotransferase

SCOPe Domain Sequences for d4ysnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ysnb1 c.67.1.0 (B:1-441) automated matches {Lactobacillus buchneri [TaxId: 1581]}
mgkldkasklideenkyyarsarinyynlvidhahgatlvdvdgnkyidllasasainvg
hthekvvkaiadqaqklihytpayfhhvpgmelseklakiapgnspkmvsfgnsgsdand
aiikfaraytgrqyivsymgsyhgstygsqtlsgsslnmtrkigpmlpsvvhvpypdsyr
typgetehdvslryfnefkkpfesflpadetacvliepiqgdggiikapeeymqlvykfc
hehgilfaidevnqglgrtgkmwaiqqfkdiepdlmsvgkslasgmplsavigkkevmqs
ldapahlfttagnpvcsaaslatldvieyeglveksatdgayakqrflemqqrhpmigdv
rmwglnggielvkdpktkepdsdaatkviyyafahgvviitlagnilrfqpplvipreql
dqalqvlddaftavengevti

SCOPe Domain Coordinates for d4ysnb1:

Click to download the PDB-style file with coordinates for d4ysnb1.
(The format of our PDB-style files is described here.)

Timeline for d4ysnb1: