Lineage for d5epcb2 (5epc B:192-304)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517507Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2517508Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2517600Family c.84.1.0: automated matches [254314] (1 protein)
    not a true family
  6. 2517601Protein automated matches [254721] (4 species)
    not a true protein
  7. 2517609Species Human (Homo sapiens) [TaxId:9606] [316254] (15 PDB entries)
  8. 2517626Domain d5epcb2: 5epc B:192-304 [316630]
    Other proteins in same PDB: d5epca4, d5epca5, d5epcb4, d5epcb5
    automated match to d5f9ca2
    complexed with gol, mg, so4

Details for d5epcb2

PDB Entry: 5epc (more details), 1.85 Å

PDB Description: crystal structure of wild-type human phosphoglucomutase 1
PDB Compounds: (B:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5epcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5epcb2 c.84.1.0 (B:192-304) automated matches {Human (Homo sapiens) [TaxId: 9606]}
veayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv

SCOPe Domain Coordinates for d5epcb2:

Click to download the PDB-style file with coordinates for d5epcb2.
(The format of our PDB-style files is described here.)

Timeline for d5epcb2: