| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) ![]() |
| Family c.84.1.0: automated matches [254314] (1 protein) not a true family |
| Protein automated matches [254721] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [316254] (14 PDB entries) |
| Domain d5epca2: 5epc A:192-304 [316625] Other proteins in same PDB: d5epca4, d5epca5, d5epcb4, d5epcb5 automated match to d5f9ca2 complexed with gol, mg, so4 |
PDB Entry: 5epc (more details), 1.85 Å
SCOPe Domain Sequences for d5epca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5epca2 c.84.1.0 (A:192-304) automated matches {Human (Homo sapiens) [TaxId: 9606]}
veayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv
Timeline for d5epca2: