Lineage for d5epca2 (5epc A:192-304)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910122Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2910123Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2910221Family c.84.1.0: automated matches [254314] (1 protein)
    not a true family
  6. 2910222Protein automated matches [254721] (4 species)
    not a true protein
  7. 2910230Species Human (Homo sapiens) [TaxId:9606] [316254] (14 PDB entries)
  8. 2910250Domain d5epca2: 5epc A:192-304 [316625]
    Other proteins in same PDB: d5epca4, d5epca5, d5epcb4, d5epcb5
    automated match to d5f9ca2
    complexed with gol, mg, so4

Details for d5epca2

PDB Entry: 5epc (more details), 1.85 Å

PDB Description: crystal structure of wild-type human phosphoglucomutase 1
PDB Compounds: (A:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5epca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5epca2 c.84.1.0 (A:192-304) automated matches {Human (Homo sapiens) [TaxId: 9606]}
veayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv

SCOPe Domain Coordinates for d5epca2:

Click to download the PDB-style file with coordinates for d5epca2.
(The format of our PDB-style files is described here.)

Timeline for d5epca2: