Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily) |
Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) |
Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins) |
Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species) |
Species Escherichia coli [TaxId:562] [52451] (7 PDB entries) |
Domain d1a9xe4: 1a9x E:4556-4676 [31662] Other proteins in same PDB: d1a9xa1, d1a9xa2, d1a9xa5, d1a9xa6, d1a9xb1, d1a9xb2, d1a9xc1, d1a9xc2, d1a9xc5, d1a9xc6, d1a9xd1, d1a9xd2, d1a9xe1, d1a9xe2, d1a9xe5, d1a9xe6, d1a9xf1, d1a9xf2, d1a9xg1, d1a9xg2, d1a9xg5, d1a9xg6, d1a9xh1, d1a9xh2 |
PDB Entry: 1a9x (more details), 1.8 Å
SCOP Domain Sequences for d1a9xe4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9xe4 c.30.1.1 (E:4556-4676) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli} stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr e
Timeline for d1a9xe4:
View in 3D Domains from other chains: (mouse over for more information) d1a9xa1, d1a9xa2, d1a9xa3, d1a9xa4, d1a9xa5, d1a9xa6, d1a9xb1, d1a9xb2, d1a9xc1, d1a9xc2, d1a9xc3, d1a9xc4, d1a9xc5, d1a9xc6, d1a9xd1, d1a9xd2, d1a9xf1, d1a9xf2, d1a9xg1, d1a9xg2, d1a9xg3, d1a9xg4, d1a9xg5, d1a9xg6, d1a9xh1, d1a9xh2 |