| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
| Protein automated matches [190615] (10 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries) |
| Domain d5enfa1: 5enf A:1315-1435 [316611] Other proteins in same PDB: d5enfa2 automated match to d3mb3a_ complexed with 5q7, edo |
PDB Entry: 5enf (more details), 1.37 Å
SCOPe Domain Sequences for d5enfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5enfa1 a.29.2.0 (A:1315-1435) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sydiqawkkqceellnlifqcedsepfrqpvdlleypdyrdiidtpmdfatvretleagn
yespmelckdvrlifsnskaytpskrsriysmslrlsaffeehissvlsdyksalrfhkr
n
Timeline for d5enfa1: