SCOPe 2.06: Domain d5enba1: 5enb A:1315-1435

Lineage for d5enba1 (5enb A:1315-1435)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)

8. Domain d5enba1: 5enb A:1315-1435 [316608]
   Other proteins in same PDB: d5enba2
   automated match to d3mb3a_
   complexed with 5q5, edo

Details for d5enba1

PDB Entry: 5enb, 1.73 Å

PDB Description: crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with o-tolylthiourea (sgc - diamond i04-1 fragment screening)

PDB Compounds: (A:) PH-interacting protein

SCOPe Domain Sequences for d5enba1:

Sequence; same for both SEQRES and ATOM records:

>d5enba1 a.29.2.0 (A:1315-1435) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sydiqawkkqceellnlifqcedsepfrqpvdlleypdyrdiidtpmdfatvretleagn
yespmelckdvrlifsnskaytpskrsriysmslrlsaffeehissvlsdyksalrfhkr
n

Timeline for d5enba1:

• d5enba1 is new in SCOPe 2.06-stable
  
• d5enba1 appears in SCOPe 2.07
  
• d5enba1 appears in the current release, SCOPe 2.08