![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.3: PapG adhesin receptor-binding domain [63680] (2 proteins) automatically mapped to Pfam PF03627 |
![]() | Protein automated matches [315530] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [315531] (6 PDB entries) |
![]() | Domain d4z3ha1: 4z3h A:0-195 [316578] Other proteins in same PDB: d4z3ha2 automated match to d4z3jc_ complexed with 4ks |
PDB Entry: 4z3h (more details), 1.5 Å
SCOPe Domain Sequences for d4z3ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z3ha1 b.2.3.3 (A:0-195) automated matches {Escherichia coli [TaxId: 562]} awnnivfyslgdvnsyqggnvvitqrpqfitswrpgiatvtwnqcngpefadgswayyre yiawvvfpkkvmtkngyplfievhnkgswseentgdndsyfflkgykwdqrafdtanlcq kpgettrltekfddiifkvalpadlplgdysvtipytsgiqrhfasylgarfkipynvak tlprenemlflfknig
Timeline for d4z3ha1: