| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) ![]() contains insert beta-sheet subdomain and C-terminal helix |
| Family b.34.6.2: Kid/PemK [82075] (4 proteins) automatically mapped to Pfam PF02452 |
| Protein automated matches [228538] (6 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [312759] (6 PDB entries) |
| Domain d5ckea1: 5cke A:2-111 [316573] Other proteins in same PDB: d5ckea2, d5ckeb2 automated match to d5ck9a_ complexed with mrd, so4 |
PDB Entry: 5cke (more details), 2.31 Å
SCOPe Domain Sequences for d5ckea1:
Sequence, based on SEQRES records: (download)
>d5ckea1 b.34.6.2 (A:2-111) automated matches {Escherichia coli [TaxId: 83333]}
vsryvpdmgdliwvdfdptkgsaqaghrpavvlspfmynnktgmclcvpcttqskgypfe
vvlsgqerdgvaladqvksiawrargatkkgtvapeelqlikakinvlig
>d5ckea1 b.34.6.2 (A:2-111) automated matches {Escherichia coli [TaxId: 83333]}
vsryvpdmgdliwvdfhrpavvlspfmynnktgmclcvpcttqskgypfevvlsgqerdg
valadqvksiawrargatkkgtvapeelqlikakinvlig
Timeline for d5ckea1: