Lineage for d5ckea1 (5cke A:2-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784275Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2784312Family b.34.6.2: Kid/PemK [82075] (4 proteins)
    automatically mapped to Pfam PF02452
  6. 2784335Protein automated matches [228538] (6 species)
    not a true protein
  7. 2784344Species Escherichia coli [TaxId:83333] [312759] (6 PDB entries)
  8. 2784349Domain d5ckea1: 5cke A:2-111 [316573]
    Other proteins in same PDB: d5ckea2, d5ckeb2
    automated match to d5ck9a_
    complexed with mrd, so4

Details for d5ckea1

PDB Entry: 5cke (more details), 2.31 Å

PDB Description: e.coli mazf e24a form iia
PDB Compounds: (A:) Endoribonuclease MazF

SCOPe Domain Sequences for d5ckea1:

Sequence, based on SEQRES records: (download)

>d5ckea1 b.34.6.2 (A:2-111) automated matches {Escherichia coli [TaxId: 83333]}
vsryvpdmgdliwvdfdptkgsaqaghrpavvlspfmynnktgmclcvpcttqskgypfe
vvlsgqerdgvaladqvksiawrargatkkgtvapeelqlikakinvlig

Sequence, based on observed residues (ATOM records): (download)

>d5ckea1 b.34.6.2 (A:2-111) automated matches {Escherichia coli [TaxId: 83333]}
vsryvpdmgdliwvdfhrpavvlspfmynnktgmclcvpcttqskgypfevvlsgqerdg
valadqvksiawrargatkkgtvapeelqlikakinvlig

SCOPe Domain Coordinates for d5ckea1:

Click to download the PDB-style file with coordinates for d5ckea1.
(The format of our PDB-style files is described here.)

Timeline for d5ckea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ckea2