Lineage for d5dckb1 (5dck B:143-212)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316392Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2316654Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2316731Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2316732Protein automated matches [191156] (10 species)
    not a true protein
  7. 2316740Species Feline immunodeficiency virus (isolate petaluma) [TaxId:11674] [316558] (1 PDB entry)
  8. 2316742Domain d5dckb1: 5dck B:143-212 [316564]
    Other proteins in same PDB: d5dcka2, d5dckb2
    automated match to d3ds5a_

Details for d5dckb1

PDB Entry: 5dck (more details), 2.29 Å

PDB Description: crystal structure of fiv capsid c-terminal domain
PDB Compounds: (B:) Capsid C-Terminal Domain

SCOPe Domain Sequences for d5dckb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dckb1 a.28.3.0 (B:143-212) automated matches {Feline immunodeficiency virus (isolate petaluma) [TaxId: 11674]}
vqlrqgakedyssfidrlfaqidqeqntaevklylkqslsiananadckkamshlkpest
leeklracqe

SCOPe Domain Coordinates for d5dckb1:

Click to download the PDB-style file with coordinates for d5dckb1.
(The format of our PDB-style files is described here.)

Timeline for d5dckb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dckb2