SCOP 1.59: Domain d1ez1b2: 1ez1 B:2-112

Lineage for d1ez1b2 (1ez1 B:2-112)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)

6. Protein Glycinamide ribonucleotide transformylase PurT [52448] (1 species)

7. Species Escherichia coli [TaxId:562] [52449] (2 PDB entries)

8. Domain d1ez1b2: 1ez1 B:2-112 [31656]
   Other proteins in same PDB: d1ez1a1, d1ez1a3, d1ez1b1, d1ez1b3

Details for d1ez1b2

PDB Entry: 1ez1, 1.75 Å

PDB Description: structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg, amppnp, and gar

SCOP Domain Sequences for d1ez1b2:

Sequence; same for both SEQRES and ATOM records:

>d1ez1b2 c.30.1.1 (B:2-112) Glycinamide ribonucleotide transformylase PurT {Escherichia coli}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm

Timeline for d1ez1b2:

• d1ez1b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ez1b2 appears in SCOP 1.57
  
• d1ez1b2 appears in SCOP 1.61
  
• d1ez1b2 appears in the current release, SCOPe 2.08