Lineage for d1ez1b2 (1ez1 B:2-112)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69114Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 69115Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 69116Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)
  6. 69186Protein Glycinamide ribonucleotide transformylase PurT [52448] (1 species)
  7. 69187Species Escherichia coli [TaxId:562] [52449] (2 PDB entries)
  8. 69191Domain d1ez1b2: 1ez1 B:2-112 [31656]
    Other proteins in same PDB: d1ez1a1, d1ez1a3, d1ez1b1, d1ez1b3

Details for d1ez1b2

PDB Entry: 1ez1 (more details), 1.75 Å

PDB Description: structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg, amppnp, and gar

SCOP Domain Sequences for d1ez1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ez1b2 c.30.1.1 (B:2-112) Glycinamide ribonucleotide transformylase PurT {Escherichia coli}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm

SCOP Domain Coordinates for d1ez1b2:

Click to download the PDB-style file with coordinates for d1ez1b2.
(The format of our PDB-style files is described here.)

Timeline for d1ez1b2: