| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
| Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
| Protein automated matches [191156] (12 species) not a true protein |
| Species Feline immunodeficiency virus (isolate petaluma) [TaxId:11674] [316558] (1 PDB entry) |
| Domain d5dcka1: 5dck A:143-211 [316559] Other proteins in same PDB: d5dcka2, d5dckb2 automated match to d3ds5a_ |
PDB Entry: 5dck (more details), 2.29 Å
SCOPe Domain Sequences for d5dcka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dcka1 a.28.3.0 (A:143-211) automated matches {Feline immunodeficiency virus (isolate petaluma) [TaxId: 11674]}
vqlrqgakedyssfidrlfaqidqeqntaevklylkqslsiananadckkamshlkpest
leeklracq
Timeline for d5dcka1: