Lineage for d5dcka1 (5dck A:143-211)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706557Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2706558Protein automated matches [191156] (12 species)
    not a true protein
  7. 2706566Species Feline immunodeficiency virus (isolate petaluma) [TaxId:11674] [316558] (1 PDB entry)
  8. 2706567Domain d5dcka1: 5dck A:143-211 [316559]
    Other proteins in same PDB: d5dcka2, d5dckb2
    automated match to d3ds5a_

Details for d5dcka1

PDB Entry: 5dck (more details), 2.29 Å

PDB Description: crystal structure of fiv capsid c-terminal domain
PDB Compounds: (A:) Capsid C-Terminal Domain

SCOPe Domain Sequences for d5dcka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dcka1 a.28.3.0 (A:143-211) automated matches {Feline immunodeficiency virus (isolate petaluma) [TaxId: 11674]}
vqlrqgakedyssfidrlfaqidqeqntaevklylkqslsiananadckkamshlkpest
leeklracq

SCOPe Domain Coordinates for d5dcka1:

Click to download the PDB-style file with coordinates for d5dcka1.
(The format of our PDB-style files is described here.)

Timeline for d5dcka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dcka2