SCOPe 2.08: Domain d5dbmc1: 5dbm C:1082-1197

Lineage for d5dbmc1 (5dbm C:1082-1197)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein CREB-binding protein, CBP [74712] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries)

8. Domain d5dbmc1: 5dbm C:1082-1197 [316557]
   Other proteins in same PDB: d5dbmc2
   automated match to d4nyxa_
   complexed with 58n

Details for d5dbmc1

PDB Entry: 5dbm, 1.86 Å

PDB Description: crystal structure of the cbp bromodomain in complex with cpi703

PDB Compounds: (C:) creb-binding protein

SCOPe Domain Sequences for d5dbmc1:

Sequence; same for both SEQRES and ATOM records:

>d5dbmc1 a.29.2.1 (C:1082-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
kkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrk
ldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

Timeline for d5dbmc1:

• d5dbmc1 first appeared in SCOPe 2.06
  
• d5dbmc1 appears in SCOPe 2.07