| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (6 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
| Protein Glycinamide ribonucleotide transformylase PurT, N-domain [52448] (1 species) |
| Species Escherichia coli [TaxId:562] [52449] (7 PDB entries) |
| Domain d1ez1a2: 1ez1 A:2-112 [31655] Other proteins in same PDB: d1ez1a1, d1ez1a3, d1ez1b1, d1ez1b3 |
PDB Entry: 1ez1 (more details), 1.75 Å
SCOP Domain Sequences for d1ez1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ez1a2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm
Timeline for d1ez1a2: