Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (48 species) not a true protein |
Species Plasmodium vivax [TaxId:5855] [234134] (20 PDB entries) |
Domain d4ufva1: 4ufv A:27-210 [316544] Other proteins in same PDB: d4ufva2, d4ufvb2, d4ufvc2 automated match to d1iica1 complexed with 31a, cl, dms, goa, mg, nhw, so4 |
PDB Entry: 4ufv (more details), 1.75 Å
SCOPe Domain Sequences for d4ufva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ufva1 d.108.1.0 (A:27-210) automated matches {Plasmodium vivax [TaxId: 5855]} dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv sdar
Timeline for d4ufva1: