SCOPe 2.08: Domain d5ckdb1: 5ckd B:2-111

Lineage for d5ckdb1 (5ckd B:2-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.2: Kid/PemK [82075] (4 proteins)
   automatically mapped to Pfam PF02452

6. Protein automated matches [228538] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [312759] (6 PDB entries)

8. Domain d5ckdb1: 5ckd B:2-111 [316542]
   Other proteins in same PDB: d5ckdb2
   automated match to d5ck9a_
   complexed with na

Details for d5ckdb1

PDB Entry: 5ckd, 1.7 Å

PDB Description: e. coli mazf e24a form iii

PDB Compounds: (B:) Endoribonuclease MazF

SCOPe Domain Sequences for d5ckdb1:

Sequence; same for both SEQRES and ATOM records:

>d5ckdb1 b.34.6.2 (B:2-111) automated matches {Escherichia coli [TaxId: 83333]}
vsryvpdmgdliwvdfdptkgsaqaghrpavvlspfmynnktgmclcvpcttqskgypfe
vvlsgqerdgvaladqvksiawrargatkkgtvapeelqlikakinvlig

Timeline for d5ckdb1:

• d5ckdb1 first appeared in SCOPe 2.06
  
• d5ckdb1 appears in SCOPe 2.07