![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (6 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
![]() | Protein Glycinamide ribonucleotide transformylase PurT, N-domain [52448] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52449] (7 PDB entries) |
![]() | Domain d1eyzb2: 1eyz B:2-112 [31654] Other proteins in same PDB: d1eyza1, d1eyza3, d1eyzb1, d1eyzb3 complexed with anp, cl, mg, mpo, na |
PDB Entry: 1eyz (more details), 1.75 Å
SCOP Domain Sequences for d1eyzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eyzb2 c.30.1.1 (B:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli} tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm
Timeline for d1eyzb2: