SCOP 1.71: Domain d1eyzb2: 1eyz B:2-112

Lineage for d1eyzb2 (1eyz B:2-112)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (6 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein Glycinamide ribonucleotide transformylase PurT, N-domain [52448] (1 species)

7. Species Escherichia coli [TaxId:562] [52449] (7 PDB entries)

8. Domain d1eyzb2: 1eyz B:2-112 [31654]
   Other proteins in same PDB: d1eyza1, d1eyza3, d1eyzb1, d1eyzb3
   complexed with anp, cl, mg, mpo, na

Details for d1eyzb2

PDB Entry: 1eyz, 1.75 Å

PDB Description: structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp

SCOP Domain Sequences for d1eyzb2:

Sequence; same for both SEQRES and ATOM records:

>d1eyzb2 c.30.1.1 (B:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm

Timeline for d1eyzb2:

• d1eyzb2 first appeared (with stable ids) in SCOP 1.55
  
• d1eyzb2 appears in SCOP 1.69
  
• d1eyzb2 appears in SCOP 1.73
  
• d1eyzb2 appears in the current release, SCOPe 2.08