Lineage for d1eyzb2 (1eyz B:2-112)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121291Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 121292Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 121293Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)
  6. 121371Protein Glycinamide ribonucleotide transformylase PurT [52448] (1 species)
  7. 121372Species Escherichia coli [TaxId:562] [52449] (2 PDB entries)
  8. 121374Domain d1eyzb2: 1eyz B:2-112 [31654]
    Other proteins in same PDB: d1eyza1, d1eyza3, d1eyzb1, d1eyzb3

Details for d1eyzb2

PDB Entry: 1eyz (more details), 1.75 Å

PDB Description: structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp

SCOP Domain Sequences for d1eyzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyzb2 c.30.1.1 (B:2-112) Glycinamide ribonucleotide transformylase PurT {Escherichia coli}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm

SCOP Domain Coordinates for d1eyzb2:

Click to download the PDB-style file with coordinates for d1eyzb2.
(The format of our PDB-style files is described here.)

Timeline for d1eyzb2: