SCOP 1.57: Domain d1eyza2: 1eyz A:2-112

Lineage for d1eyza2 (1eyz A:2-112)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)

6. Protein Glycinamide ribonucleotide transformylase PurT [52448] (1 species)

7. Species Escherichia coli [TaxId:562] [52449] (2 PDB entries)

8. Domain d1eyza2: 1eyz A:2-112 [31653]
   Other proteins in same PDB: d1eyza1, d1eyza3, d1eyzb1, d1eyzb3

Details for d1eyza2

PDB Entry: 1eyz, 1.75 Å

PDB Description: structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp

SCOP Domain Sequences for d1eyza2:

Sequence; same for both SEQRES and ATOM records:

>d1eyza2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT {Escherichia coli}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm

Timeline for d1eyza2:

• d1eyza2 first appeared (with stable ids) in SCOP 1.55
  
• d1eyza2 appears in SCOP 1.59
  
• d1eyza2 appears in the current release, SCOPe 2.08