Lineage for d1eyza2 (1eyz A:2-112)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2861873Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 2862023Protein Glycinamide ribonucleotide transformylase PurT, N-domain [52448] (1 species)
  7. 2862024Species Escherichia coli [TaxId:562] [52449] (7 PDB entries)
  8. 2862037Domain d1eyza2: 1eyz A:2-112 [31653]
    Other proteins in same PDB: d1eyza1, d1eyza3, d1eyzb1, d1eyzb3
    complexed with anp, cl, mg, mpo, na

Details for d1eyza2

PDB Entry: 1eyz (more details), 1.75 Å

PDB Description: structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp
PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase 2

SCOPe Domain Sequences for d1eyza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyza2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]}
tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm

SCOPe Domain Coordinates for d1eyza2:

Click to download the PDB-style file with coordinates for d1eyza2.
(The format of our PDB-style files is described here.)

Timeline for d1eyza2: