SCOPe 2.08: Domain d4z3ga1: 4z3g A:0-196

Lineage for d4z3ga1 (4z3g A:0-196)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.3: PapG adhesin receptor-binding domain [63680] (2 proteins)
   automatically mapped to Pfam PF03627

6. Protein automated matches [315530] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [315531] (6 PDB entries)

8. Domain d4z3ga1: 4z3g A:0-196 [316524]
   Other proteins in same PDB: d4z3ga2, d4z3gb2
   automated match to d4z3jc_
   complexed with 4ks, mes

Details for d4z3ga1

PDB Entry: 4z3g, 1.45 Å

PDB Description: crystal structure of the lectin domain of papg from e. coli bi47 in complex with 4-methoxyphenyl beta-d-galabiose in space group p212121

PDB Compounds: (A:) PapG, lectin domain

SCOPe Domain Sequences for d4z3ga1:

Sequence; same for both SEQRES and ATOM records:

>d4z3ga1 b.2.3.3 (A:0-196) automated matches {Escherichia coli [TaxId: 562]}
awnnivfyslgdvnsyqggnvvitqrpqfitswrpgiatvtwnqcngpefadgswayyre
yiawvvfpkkvmtkngyplfievhnkgswseentgdndsyfflkgykwdqrafdtanlcq
kpgettrltekfddiifkvalpadlplgdysvtipytsgiqrhfasylgarfkipynvak
tlprenemlflfknigg

Timeline for d4z3ga1:

• d4z3ga1 first appeared in SCOPe 2.06
  
• d4z3ga1 appears in SCOPe 2.07