Lineage for d4za0b2 (4za0 B:141-432)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836769Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 2836770Protein Enolase [51606] (11 species)
    Fold of this protein slightly differs from common fold in topology
  7. 2836820Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (15 PDB entries)
    Uniprot P09104
  8. 2836850Domain d4za0b2: 4za0 B:141-432 [316519]
    Other proteins in same PDB: d4za0a1, d4za0b1
    automated match to d2akza1
    complexed with mg, pah

Details for d4za0b2

PDB Entry: 4za0 (more details), 2.31 Å

PDB Description: structure of human enolase 2 in complex with phosphonoacetohydroxamate
PDB Compounds: (B:) Gamma-enolase

SCOPe Domain Sequences for d4za0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4za0b2 c.1.11.1 (B:141-432) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky
gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld
fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl
tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnps

SCOPe Domain Coordinates for d4za0b2:

Click to download the PDB-style file with coordinates for d4za0b2.
(The format of our PDB-style files is described here.)

Timeline for d4za0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4za0b1